################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 04:06:39 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/prt.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1hgxa.pdb # 2: 1hmpa.pdb # 3: 1nula.pdb # # Length: 233 # Identity: 11/233 ( 4.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/233 ( 24.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 110/233 ( 47.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1hgxa.pdb 1 ------------------------MDDLERV---LYNQDDIQKRIRELAAELTEFYEDKN 33 1hmpa.pdb 1 SPGVVISDDEPGYDLDLFCIPNHYAEDLERV---FIPHGLIMDRTERLARDVMKEMGGHH 57 1nula.pdb 1 -------------------------------EKYIVTWDMLQIHARKLASRLM-PSEQW- 27 d iq r r LA lm e 1hgxa.pdb 34 PVMICVLT-GAVFFYTDLLKHLD---------FQ-LEPDYIICS-SLTISKDLKT----- 76 1hmpa.pdb 58 IVALCVLKG-GYKFFADLLDYIKALNRNSDRSIP-MTVDFIRLKSY-CNDQSTGDIKVIG 114 1nula.pdb 28 KGIIAVSR-GGLVPGALLARELG-----------IRHVDTVCIS-SLKVLKRAEG----- 69 v icVl g f adLl l vD i s s k 1hgxa.pdb 77 -----NIEGRHVLVVEDIIDTG-LTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDV-- 128 1hmpa.pdb 115 GDDLSTLTGKNVLIVEDIIDTG-KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSV-GY-- 170 1nula.pdb 70 -----DGE--GFIVIDDLVDT-GGTAVAIREMYP-----KAHFVTIFAKPA-------GR 109 e vlvveDiiDT Tm ll kv tl K 1hgxa.pdb 129 -PIDYCGFVVENRYIIGYGFDFHNKYRNLPV--IGILKE-------------- 164 1hmpa.pdb 171 -KPDFVGFEIPDKFVVGYALDYNEYFRDLNH--VCVISETGKAKYKA------ 214 1nula.pdb 110 PLVDDYVVDIPQDTWIE-------Q------PWDMGVVFV-------PPISGR 142 D gf ip ig e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################