################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 04:06:35 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/pot.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1a1yi.pdb # 2: 1cis.pdb # 3: 1csei.pdb # # Length: 67 # Identity: 17/ 67 ( 25.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 57/ 67 ( 85.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 67 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1a1yi.pdb 1 -KTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTI--VTMEYRIDRVRLFVD-KLDNI 56 1cis.pdb 1 MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLEKQAVDNAYAEYRIDRVRLAVD-KLDNI 59 1csei.pdb 1 --KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSP--VTLDLRYNRVRVFYNPGTNVV 56 tewPElVGKsVeeAkkvilqdkPeaqiivLp g vt eyRidRVRlfvd kldni 1a1yi.pdb 57 AEVPRVG 63 1cis.pdb 60 AQVPRVG 66 1csei.pdb 57 NHVPHVG 63 a VPrVG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################