################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 10:34:57 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/hpr.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: 1pch.pdb # 2: 1poh.pdb # 3: 1ptf.pdb # 4: 1zer.pdb # 5: 2hid.pdb # # Length: 100 # Identity: 10/100 ( 10.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/100 ( 27.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/100 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1pch.pdb 1 -AKFSAIITDKVGLHARPASVLAKEASK-FSSNITIIANEKQGNLKSIMNVMAMAIKTG- 57 1poh.pdb 1 MFQQEVTITAPNGLHTRPAAQFVKEAKG-FTSEITVTSNGKSASAKSLFKLQTLGLTQG- 58 1ptf.pdb 1 MEKKEFHIVAETGIHARPATLLVQTASK-FNSDINLEYKGKSVNLKSIMGVMSLGVGQG- 58 1zer.pdb 1 MEQNSYVIIDETGIHARP-ATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGK-D 58 2hid.pdb 1 -AQKTFKVTADSGIHARPATVLVQTASK-YDADVNLEYNGKTVNLKSIMGVVSLGIAKG- 57 i G HaRP a f s i ngK nlKSim v lg 1pch.pdb 58 TEITIQADGNDADQA----I-QAIKQTMIDTALIQG---- 88 1poh.pdb 59 TVVTISAEGEDEQKA----V-EHLVKLMAELE-------- 85 1ptf.pdb 59 SDVTITVDGADEAEG----M-AAIVETLQKEGLA------ 87 1zer.pdb 59 AEITIYADGS-----DESDAIQAISDVLSK------EGLT 87 2hid.pdb 58 AEITISASGADENDA----L-NALEETMKSEGLGE----- 87 TI a G a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################