################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:03:07 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/gag_p17.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ed1a.pdb # 2: 1hiwa.pdb # # Length: 123 # Identity: 55/123 ( 44.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/123 ( 44.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/123 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ed1a.pdb 1 SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLA 60 1hiwa.pdb 1 -VLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQ 59 VLSG D EKIRLRPGGKK Y LKH VWA EL RF LLE EGC IL L 1ed1a.pdb 61 PLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP------ 114 1hiwa.pdb 60 PSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSK-------KKAQQA 112 P TGSE L SLYNT V C H VK T EA 1ed1a.pdb --- 1hiwa.pdb 113 AAD 115 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################