################################################################################################ # Program: MUSTANG v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, P. J. Stuckey, J. C. Whisstock, and A. M. Lesk # Rundate: Wed Aug 31 20:42:57 2005 # Report_file: eIF6.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1g61a.pdb # 2: 1g62a.pdb # # Length: 229 # Identity: 74/229 ( 32.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 74/229 ( 32.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/229 ( 3.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1g61a.pdb 1 MIIRKYFSGIPTIGVLALTTEEITLLPIFLDKDDVNEVSEVL--ETKCLQTNIGGSSLVG 58 1g62a.pdb 1 MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60 M R F IGV T L L T I G G 1g61a.pdb 59 SLSVANKYGLLLPKIVEDEELDRIKNFLKENNLD-LNVEIIKSKNTALGNLILTNDKGAL 117 1g62a.pdb 61 RMTAGNRRGLLVPTQTTDQELQHLRNSL----PDSVKIQRVEERLSALGNVICCNDYVAL 116 N GLL P D EL N L D ALGN I ND AL 1g61a.pdb 118 IS-PELKDFKKDIEDSLNVEVEIGTIAELPTVGSNAVVTNKGCLTHPLVEDDELEFLKSL 176 1g62a.pdb 117 VHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSL 176 I D L VEV TI VGS N G L HP E L SL 1g61a.pdb 177 FKVEYIGKGTANKGTTSVGACIIANSKGAVVGGDTTGPELLIIEDALGL 225 1g62a.pdb 177 LQV-PLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRL 224 V GT N G VGA N AV G DTT PEL IE L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################