################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:47:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/cyto.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1bgc.pdb # 2: 1bgd.pdb # 3: 1rhga.pdb # # Length: 158 # Identity: 109/158 ( 69.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 140/158 ( 88.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/158 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bgc.pdb 1 SLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQAPLSSCSSQ 60 1bgd.pdb 1 -LPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQ 59 1rhga.pdb 1 -LPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPL------ 53 LPQSFLLKCLEQvRKiQaDGaaLQE LCAthkLCHPEELvLLgHsLGIPqaPL 1bgc.pdb 61 SLQLRGCLNQLHGGLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDLGAA 120 1bgd.pdb 60 ALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMA 119 1rhga.pdb 54 ---LAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGM- 109 L GCL QLHsGLFLYQGLLQALaGISPELaPTLDTLQLDvtDFAtnIWqQMEdLGm 1bgc.pdb 121 PAMPTFTSAFQRRAGGVLVASQLHRFLELAYRGLRYLA 158 1bgd.pdb 120 PTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFA 157 1rhga.pdb 110 --MPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLA 145 MPaFtSAFQRRAGGVLVAS LqsFLElaYR LRhlA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################