################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:31:56 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/cks.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1buhb.pdb # 2: 1cksa.pdb # 3: 1puc.pdb # # Length: 122 # Identity: 27/122 ( 22.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/122 ( 40.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 67/122 ( 54.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1buhb.pdb 1 ------------------------QIYYSDKYDDEEFEYRHVMLPKDIAKLVP------- 29 1cksa.pdb 1 ---------------------AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVP------- 32 1puc.pdb 1 SKSGVPRLLTASERERLEPFI--DQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPE 58 QIyYSdkY DeeyEYRHVMLPk K vP 1buhb.pdb 30 ---KTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRR---PL-----------P-- 70 1cksa.pdb 33 ---KTHLMSEEEWRRLGVQQSLGWVHYMIHEP---------EP-H-IL-----LFR-RPL 72 1puc.pdb 59 TGT-LRILQEEEWRGLGITQSLGWEMYE-V-H---------VPE--PHILLFKREKD--- 101 thlmsEeEWR LGvqQSlGWvhYm h p 1buhb.pdb -- 1cksa.pdb 73 PK 74 1puc.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################