################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 00:05:07 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Usp.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1jmva.pdb # 2: 1mjha.pdb # # Length: 167 # Identity: 26/167 ( 15.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/167 ( 15.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 51/167 ( 30.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1jmva.pdb 1 -MYKHILVAVDLSEESPILLKKAVGIAKRH--DAKLSIIHVDVNFSDLYTGLIDVNMSSM 57 1mjha.pdb 1 VMYKKILYPTDFSETAEIALKHVKAFKT--LKAEEVILLHVIDER------------EIK 46 MYK IL D SE I LK HV 1jmva.pdb 58 QDRIS-------------TETQKALLDLAESVD-YPI-SEKLSGSGDLGQVLSDAIEQYD 102 1mjha.pdb 47 -----VEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEG 101 E G E 1jmva.pdb 103 VDLLVTGHHQDF--------WSKLMSSTRQVMNTIKIDMLVVPLR-D 140 1mjha.pdb 102 VDIIIMGSH-GKTNLKEILLGSV----TENVIKKSNKPVLVVKRKNS 143 VD G H S T V LVV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################