################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:42:00 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Topoisomerase_I_core.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1a31a.pdb # 2: 1a41.pdb # # Length: 273 # Identity: 33/273 ( 12.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/273 ( 12.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 84/273 ( 30.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1a31a.pdb 1 PSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKS--KEMKVRQRAVALYFIDKLALR 58 1a41.pdb 1 --NAKRD-------RIFVRVYNVMKRINCFINKNIKKSST-DSNYQLAVFMLMETMF--- 47 R I K Q AV 1a31a.pdb 59 AGNEKEEGETADTV-------GCCSLRVEHINLHPELDGQEYVVEFDFLGKD-SIRYYNK 110 1a41.pdb 48 --------------FKENETVGLLTLKNKHIEISPD----EIVIKFVGK---DKVSHEFV 86 G L HI P E V F 1a31a.pdb 111 VPVE-KRVFKNLQLFMENK--QPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASIT 167 1a41.pdb 87 VH-KSNRLYKPLLKLTD--DSSPEEFLFNKLSERKVYECIKQFG--IRIKDLRTYGVNYT 141 V R K L PE LF L K RTY T 1a31a.pdb 168 LQQQLKELTA---PDE-NIPAKILSYNRANRAVKLNL--------DPRITVAWCKKWGV- 214 1a41.pdb 142 FLYNFWTNVKSISPLPSPKKLIALTIKQTAEVV----GHTPSISKRAYMATTILEMVK-D 196 P L V 1a31a.pdb 215 -PIEKIYNKT---QREKFAWAIDMADEDYEF-- 241 1a41.pdb 197 KNFLDVVS--KTTFDEFLSIVVDHV------KS 221 E D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################