################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Mon Jul 25 15:41:49 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Terpene_synth_N.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1n1ba.pdb # 2: 5eau.pdb # # Length: 219 # Identity: 64/219 ( 29.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 64/219 ( 29.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 37/219 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1n1ba.pdb 1 LW----DSNYIQSLNTPYT-----EERHLDRKAELIVQVRILLKE-KMEPVQQLELIHDL 50 5eau.pdb 1 --SPSLWGDQFLSFS----IDNQVAEKYAKEIEALKEQTRNMLLATGMKLADTLNLIDTI 54 S E L Q R L M L LI 1n1ba.pdb 51 KYLGLSDFFQDEIKEILGVIYNEHKCFHNNEVEKMDLYFTALGFRLLRQHGFNISQDVFN 110 5eau.pdb 55 ERLGISYHFEKEIDDILDQIYNQN-S------NCNDLCTSALQFRLLRQHGFNISPEIFS 107 LG S F EI IL IYN DL AL FRLLRQHGFNIS F 1n1ba.pdb 111 CFKNEKG-IDFKASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKL-D-DEN 167 5eau.pdb 108 KFQD--ENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP 165 F FK SLA D G L LYEAS D LE A F T L 1n1ba.pdb 168 LLLWIRHSLDLPLHWRIQSVEARWFIDAYARRP-----D 201 5eau.pdb 166 LREQVTHALEQCLHKGV---PRVETRFFISSI-YDKEQS 200 L H L LH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################