################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:19:44 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/START.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1em2a.pdb # 2: 1jssa.pdb # # Length: 216 # Identity: 43/216 ( 19.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/216 ( 19.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/216 ( 10.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1em2a.pdb 1 SFSAQEREYIRQGKEATAVVDQILAQEE-NWKFEKNNEYGDTVYTIEVPFH-GKTFILKT 58 1jssa.pdb 1 ---------ASISTKLQNTLIQYHSIEEDEWRVAKKAK-DVTVWRKPSEEFNGYLYKAQG 50 Q EE W K TV G 1em2a.pdb 59 FLPCPAELVYQEVILQPE-RVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDF 117 1jssa.pdb 51 VMDDVVNNVIDHIRP-GPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREF 109 V R W T L E N AG SPR F 1em2a.pdb 118 VNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGG-IVLKSASNPRVCTFVWILN 176 1jssa.pdb 110 VDFSYTVGYEEGLLSCGVSVEWS-ET-RPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQ 167 V LS G S VRG N P G P 1em2a.pdb 177 TDLKGRLPRYLIHQSLAAT-FEFAFHLRQRISELGA 211 1jssa.pdb 168 TDLRGMIPQSAVDTAMASTLANFYSDLRKGLR---- 199 TDL G P A T F LR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################