################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:17:45 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/SLT.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 154l.pdb # 2: 1qsaa.pdb # # Length: 229 # Identity: 27/229 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/229 ( 11.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 105/229 ( 45.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 154l.pdb 1 RTDCYGNVNRIDTTGASCKTAKPEGLSYCGVSASKKIAERDLQAMDRYKTIIKKVGEKLC 60 1qsaa.pdb 1 ---------------------------------------------LAYNDLFKRYTSGKE 15 Y K 154l.pdb 61 VEPAVIAGIISRESHAGKVLKNGWGDRGNGFGLMQVDKRSHK------PQGT------WN 108 1qsaa.pdb 16 IPQSYAMAIARQESAWNP---KVKSP-VGASGLMQIMPGTATHTVKMFSIPGYSSPGQLL 71 I ES GLMQ 154l.pdb 109 -GEVHITQGTTILINFIKTIQKKFPSWTKDQ-QLKGGISAYNAGAGNVR----------S 156 1qsaa.pdb 72 DPETNINIGTSYLQYVYQQFG----------NNRIFSSAAYNAGPGRVRTWLGNSAGRID 121 E I GT L AYNAG G VR 154l.pdb 157 YARMDIGTTHD-----DYANDVVARAQYYKQHG-Y-------------- 185 1qsaa.pdb 122 AVAFVESIP--FSETRGYVKNVLAYDAYYRYFMGDKPTLMSATEWGRRY 168 Y V A YY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################