################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:04:12 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L5_NC.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1iq4a.pdb # 2: 1jj2d.pdb # # Length: 201 # Identity: 42/201 ( 20.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/201 ( 20.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 83/201 ( 41.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1iq4a.pdb 1 MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLI 60 1jj2d.pdb 1 ----------------------FHEMREPRIEKVVVHMGIG-H------AN-AEDILGEI 30 M P IEK V MG G A L I 1iq4a.pdb 61 AGQRPVVTRAKKSIAGFR-LRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFR-GVS 118 1jj2d.pdb 31 TGQMPVRTKAKRTVGEF-DIREGDPIGAKVTLRDEMAEEFLQTALPL---------AELA 80 GQ PV T AK F R G PIGAKVTLR E EFL 1iq4a.pdb 119 KKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTT-A----------------- 160 1jj2d.pdb 81 TSQFDDTGNFSFG--------------------LDVTVNLVRPGYRVAKRDKASRSIPTK 120 FD GN G D 1iq4a.pdb 161 --NTDEEARELLALLGMPFQK 179 1jj2d.pdb 121 HRLNPADAVAFIESTYDVEV- 140 A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################