################################################################################################
# Program: MUSTANG-Lite v0.1: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 23:03:44 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L2_C.html
################################################################################################
#====================================
# Aligned_structures: 2
#   1: 1jj2a.pdb
#   2: 1rl2a.pdb
#
# Length:         71
# Identity:       27/ 71 ( 38.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     27/ 71 ( 38.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 71 (  7.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


1jj2a.pdb               1  ---LPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDP   57
1rl2a.pdb               1  GNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQVLGKEGKYVIVRLASGEVRILGK   60
                              LPL  IP G  V N E  PG GG   RA G  AQ L        V L SGE   L  

1jj2a.pdb              58  QCRATIGVVGG   68
1rl2a.pdb              61  CRATVGEV-G-   69
                                  V G 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################