################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:03:27 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1jj2a.pdb # 2: 1rl2a.pdb # # Length: 142 # Identity: 60/142 ( 42.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/142 ( 42.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/142 ( 6.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1jj2a.pdb 1 SHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE 60 1rl2a.pdb 1 --QYRIIDFKRDK---DGIPGRVATIEYDPNRSANIALINYADGEKRYIIAPKNLKVG-E 54 Y R D I G V IE DP RSA A DG R I AP VG E 1jj2a.pdb 61 LQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVK 120 1rl2a.pdb 55 I-SGPDADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQVLGKEGKYVIVR 113 G DA I GN LPL IP G V N E PG GG RA G AQ L V 1jj2a.pdb 121 LPSGEMKRLDPQCRATIGVVGG 142 1rl2a.pdb 114 LASGEVRILGKC-RATVGEVG- 133 L SGE L RAT G VG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################