################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:27:37 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Phage_G.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1cd3g.pdb # 2: 1gff2.pdb # # Length: 181 # Identity: 71/181 ( 39.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/181 ( 39.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/181 ( 5.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1cd3g.pdb 1 MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNA--GNGGFLH 58 1gff2.pdb 1 MFQKFISKHNAPINSTQLA-ATKTPAVAAPVLSVPNLSRSTILINA-TTTAVTTHSGLCH 58 MFQ FIS HN S L TPA APVL P ST T A G H 1cd3g.pdb 59 CIQMDTSVNAANQVVSVGADIAFDAD-PKFFACLVRFESS--SVPTTLPTAYDVYPLNGR 115 1gff2.pdb 59 VVRIDETNPTNHHALSIAGSLSN--VPADMIAFAIRFEVADGVVPTAVPALYDVYPIETF 116 D S A RFE VPT P YDVYP 1cd3g.pdb 116 HDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSN-FTATKCRGLVSLNQVIKEIICLQPL 174 1gff2.pdb 117 NNGKAISFKDAVTIDSHPRTVGNDVYAGIMLWSNAWTASTISGVLSVNQVNREATVLQPL 176 G KD VTID PRT GN VY G M WSN TA G S NQV E LQPL 1cd3g.pdb 175 K 175 1gff2.pdb 177 K 177 K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################