################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:54:17 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/PTS_EIIA_2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1a3aa.pdb # 2: 1a6ja.pdb # # Length: 157 # Identity: 30/157 ( 19.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/157 ( 19.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/157 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1a3aa.pdb 1 LF-----KLGAENIFLGRKAATKEEAIRFAGEQLVKGGYV-EPEYVQAMLDREKLTPTYL 54 1a6ja.pdb 1 --LQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGI 58 L E K A E K A L REK T 1a3aa.pdb 55 GESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFG-EEEDDIARLVIGIAARNNEH---IQ 110 1a6ja.pdb 59 GNGIAIPHGKL--EEDTLRAVGVFVQLETPIAFDAIDN-QPVDLLFALLVPADQTKTHLH 115 G IA PHG L VF Q F L 1a3aa.pdb 111 VITSLTNALDDESVIERLAHTTSVDEVLELLAGRK-- 145 1a6ja.pdb 116 TLSLVAKRLADKTICRRLRAAQSDEELYQIITD--TE 150 L D RL S E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################