################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Mon Jul 25 15:29:10 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/NHase_beta.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ireb.pdb # 2: 2ahjb.pdb # # Length: 238 # Identity: 61/238 ( 25.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/238 ( 25.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 37/238 ( 15.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ireb.pdb 1 MNGVYDVGGTDGLGPINR--P-ADEPVFRAEWEKVAFAMFPATFR-AGFMGLDEFRFGIE 56 2ahjb.pdb 1 MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVE 60 M GV D G G G P F AEWE A G DE R E 1ireb.pdb 57 QMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENP--DAPLPEHEQKPE 114 2ahjb.pdb 61 RMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAG------GPFPLSRP------ 108 M P Y PYY V G ELE 1ireb.pdb 115 LIEFVNQAVYGGLPASREVDRPP-KFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHH 173 2ahjb.pdb 109 --------SESEG--RPAPVET-TTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRT 157 F G VR GH R Y RG GT 1ireb.pdb 174 GAYIY-PDTAGNGLG-ECPEHLYTVRFTAQELWGPEGDPN-SSVYYDCWEPYIELVDT 228 2ahjb.pdb 158 TEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTD--GGSVVVDLFEGYLEPA-- 211 PD G G E Y V F A EL G D SV D E Y E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################