################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Mon Jul 25 15:27:21 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/MAAL_N.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1kd0a.pdb # 2: 1kkoa.pdb # # Length: 159 # Identity: 93/159 ( 58.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 93/159 ( 58.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/159 ( 1.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1kd0a.pdb 1 KIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLED 60 1kkoa.pdb 1 KIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILEN 60 KI L T G FYFDDQ AIK GAGHDGF YTG VT GFT VRQ GE SV L LE 1kd0a.pdb 61 GQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPA-EEFD-KTV 118 1kkoa.pdb 61 GAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRI 120 G VA GDCAAVQYSGAGGRDPLFLA FIP I P L GR F P FD 1kd0a.pdb 119 NGNRLHTAIRYGITQAILDAVAKTRKVT-AEVIRDEYNP 156 1kkoa.pdb 121 DGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQL 159 GN LHTA RYG QA LDA A EV DE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################