################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:50:39 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Jacalin.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1jaca.pdb # 2: 1jota.pdb # # Length: 133 # Identity: 106/133 ( 79.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 106/133 ( 79.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/133 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1jaca.pdb 1 GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDF 60 1jota.pdb 1 GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITGFKPVKISLEF 60 G FDDGA TGIREIN YN ETAIG V YDLNG P V HKSFITGF PVKISL F 1jaca.pdb 61 PSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSI 120 1jota.pdb 61 PSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSI 120 PSEYI EVSGY G V GY V RSLTFKTNK TYGPYGVT GTPF LPIENGLIVGFKGSI 1jaca.pdb 121 GYWLDYFSMYLSL 133 1jota.pdb 121 GYWLDYFSIYLSL 133 GYWLDYFS YLSL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################