################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:30:49 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Heme_oxygenase.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1dvga.pdb # 2: 1qq8a.pdb # # Length: 215 # Identity: 175/215 ( 81.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 175/215 ( 81.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/215 ( 1.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1dvga.pdb 1 SQDLSEALKEATKEVHIRAENSE--FRNFQKGQVSREGFKLVTASLYHIYTALEEEIERN 58 1qq8a.pdb 1 PQDLSEALKEATKEVHTQAENA-EFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERN 59 QDLSEALKEATKEVH AEN RNFQKGQV R GFKLV ASLYHIY ALEEEIERN 1dvga.pdb 59 KQNPVYAPLYFPEELHRRAALEQDLAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPEL 118 1qq8a.pdb 60 KESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPEL 119 K PV AP YFPEELHR AALEQDLAFWYGP WQE IPYTPA Q YVKRLHEVG T PEL 1dvga.pdb 119 LVAHAYTRYLGDLSGGQVLKKIAQKALALPSSGEGLASFTFPSIDNPTKFKQLYRAR-NT 177 1qq8a.pdb 120 LVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNS 179 LVAHAYTRYLGDLSGGQVLKKIAQKAL LPSSGEGLA FTFP I TKFKQLYR R N 1dvga.pdb 178 LELTPEVKHRVTEEAKTAFLLNIELFEELQALLTE 212 1qq8a.pdb 180 LEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTH 214 LE TP V RV EEAKTAFLLNI LFEELQ LLT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################