################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:23:10 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Glyco_transf_8.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ga8a.pdb # 2: 1ll3a.pdb # # Length: 312 # Identity: 41/312 ( 13.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/312 ( 13.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 92/312 ( 29.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ga8a.pdb 1 ----DIV-FAADDNYAAYLCVAAKSVEAAHPDTEIRFHVLDA-GISEANRAAVAANLRGG 54 1ll3a.pdb 1 MTDQAFVTLTTNDAYAKGALVLGSSLKQHRT--SRRLAVLTTPQVSDTMRKALEIVFD-- 56 V D YA V S R VL S R A 1ga8a.pdb 55 GGNIRFIDVNPEDF----AGFPLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDS 110 1ll3a.pdb 57 ---EVITVDI-LDSGDSAHLTLMKRPEL-GVTLTKLHCWS-LTQYSKCVFMDADTLVLAN 110 D T L K D D LV 1ga8a.pdb 111 LTPLWDTDLGDNW-LGASIDLFVERQEGYKQKIGADGE-YYFNAGVLLINLK-KWRRHDI 167 1ll3a.pdb 111 IDDLFER-E----ELSAAPDPG-W--------------PDCFNSGVFVYQPSVETY---- 146 L L A D FN GV 1ga8a.pdb 168 FKSSEWVEQYKDVQ---YQDQDILNGLFKGGV-----CYANSRFNFP-TNYAFASRHT-D 217 1ll3a.pdb 147 NQLLHVASEQG---SFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYS-----YL 198 DQ LN F N 1ga8a.pdb 218 PLYRDRTNTVPVAVSHYCGPAKPWHR-DCTA-----------W---GAERFTELAGSLTT 262 1ll3a.pdb 199 PAFKAFGA--NAKVVHFLGQTKPWNYTY---DTKTKSVRSEMTHPQFLNVWWDIFTTSV- 252 P V H G KPW 1ga8a.pdb 263 V---PEEWRGKL 271 1ll3a.pdb 253 -VPLLQQFGL-- 261 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################