################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:04:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/GFO_IDH_MocA_NC.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1gcua.pdb # 2: 1ofga.pdb # # Length: 402 # Identity: 51/402 ( 12.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/402 ( 12.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 131/402 ( 32.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1gcua.pdb 1 MD--------------------------AEPKRKFGVVVVGVGRA---GSVRLRDLKDPR 31 1ofga.pdb 1 --ATLPAGASQVPTTPAGRPMPYAIRPMPEDR-RFGYAIVGLG--KYALNQILPGFAG-- 53 E FG VG G L 1gcua.pdb 32 SAAFLNLIGFVSRRELGS-------LDEV---RQI---SLEDALRSQEIDVAYICSESSS 78 1ofga.pdb 54 C-QHSRIEALVSGNAE--KAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSL 110 VS V ID YI S 1gcua.pdb 79 HEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRRE 138 1ofga.pdb 111 HAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKL 170 H AGKHV E PM S A Q A L 1gcua.pdb 139 VL-G--KELLKGSLRFTASP----------LEEERFGFP--AFSGISRLTWLVSLFGELS 183 1ofga.pdb 171 IRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEP 230 L L E G GI L L GE 1gcua.pdb 184 L-ISATLEERKEDQY------MKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGS 236 1ofga.pdb 231 IEVRAYTYSDPNDE-RFVEVEDRIIWQMRFRSGALSHGASSYS--TTTTSRFSVQGDKAV 287 A D Q L Q 1gcua.pdb 237 L-EE-VP--------------SVGVNK--------NIFLKDQDIFVQKLLD-QVSAEDLA 271 1ofga.pdb 288 LLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNK------- 340 L N F D 1gcua.pdb 272 A----EKKRIMHCLGLASDIQKLCH----------------- 292 1ofga.pdb 341 -PVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 381 M L I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################