################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:20:19 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Dala_Dala_ligas_N.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ehia.pdb # 2: 1iow.pdb # # Length: 136 # Identity: 30/136 ( 22.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/136 ( 22.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 44/136 ( 32.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ehia.pdb 1 -KKRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQNGFFLDTESSKKILA 59 1iow.pdb 1 MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGG-IDAYPVDPK---------------- 43 A GG S E VS S G 1ehia.pdb 60 LEDEQPIVDAFMKTVDASDPLA--RIHALKSAGDFDIFFPVVHGNLGEDGTLQGLFKLLD 117 1iow.pdb 44 ----------------------EVDVTQLKS-MGFQKVFIALHGRGGEDGTLQGMLELMG 80 LKS F F HG GEDGTLQG L 1ehia.pdb 118 KPYVGAPLRGHAVSF- 132 1iow.pdb 81 LPYTGSGVMASALSMD 96 PY G A S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################