################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:27:22 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/DNA_mis_repair_M.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1b63a.pdb # 2: 1h7sa.pdb # # Length: 136 # Identity: 15/136 ( 11.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/136 ( 11.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/136 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1b63a.pdb 1 GTAFLEQALAIEWQH------------------GDLTLRGWVADPNH--TTPALAEIQYC 40 1h7sa.pdb 1 GQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRS-STDRQFF 59 G L G H Q 1b63a.pdb 41 YVNGRMMRDRLINHAIRQACEDKLG-ADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQS 99 1h7sa.pdb 60 FINRRPCDPAKVCRLVNEVYHY---NRHQYPFVVLNISVDSECVDI-----N-QILLQEE 110 N R Q P VL D VD 1b63a.pdb 100 RLVHDFIYQGVLSVLQ 115 1h7sa.pdb 111 KLLLAVLKTSLIGFD- 125 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################