################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:15:11 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Cytidylyl_trans.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ezia.pdb # 2: 1h7ea.pdb # # Length: 265 # Identity: 30/265 ( 11.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/265 ( 11.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 74/265 ( 27.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ezia.pdb 1 EKQNIAVILARQNSKGLPLKNLRK-NGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEA 59 1h7ea.pdb 1 -SKAVIVIPARYGSSRLPGKPLLDIVGKPMIQHVYERALQVAGVAEVWVATDDPRVEQAV 59 VI AR S LP K L G H A V TD 1ezia.pdb 60 KNFGVEVVLRPAA---SSISGVIHALETIGSNSGT-VTLLQPTSPLRTGAHIREAFSLFD 115 1h7ea.pdb 60 QAFGGKAIMTRN-DHESGTDRLVEVMHKVEA-D--IYINLQGDEPMIRPRDVETLLQGMR 115 FG S LQ P 1ezia.pdb 116 E--KIKGSVVSACPEHHPLKTLL-------QIN-E----YAP-------RHLSDLEQPRQ 154 1h7ea.pdb 116 -DDPALPVATLCHAI-SAAEAA-EPSTVKVVVNTRQDALYFSRSPIPYPRNAE------- 165 N Y R 1ezia.pdb 155 QLPQAFRPNGAIYINDTASLIANN------------CFFI------APTKLYISHQD--- 193 1h7ea.pdb 166 -KARYLKHV-GIYAYRRDVLQNYSQLPESMPEQAESLEQLRLMNAGINIRTFEV---AAT 220 IY L 1ezia.pdb 194 SIDIDTELDLQQAENILN------- 211 1h7ea.pdb 221 GPGVDTPACLEKVRALMAQELAENA 245 DT L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################