################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:59:18 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Bet_v_I.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bv1.pdb # 2: 1e09a.pdb # # Length: 160 # Identity: 94/160 ( 58.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 94/160 ( 58.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/160 ( 1.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bv1.pdb 1 GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60 1e09a.pdb 1 GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 60 GVF YE E TS IP RLFKAF LD DNL PK APQAI E EG GGPGTIKKI F E 1bv1.pdb 61 GLPF-KYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 119 1e09a.pdb 61 GS-QYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 119 G YVK D D N Y Y IEG GDTLEKIS E K VA P GGSI K 1bv1.pdb 120 YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159 1e09a.pdb 120 YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 159 YHTKG E K E VKA KE L E YL H DAYN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################