################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:55:42 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/ATP-synt_g.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1e79g.pdb # 2: 1fs0g.pdb # # Length: 295 # Identity: 37/295 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/295 ( 12.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 108/295 ( 36.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1e79g.pdb 1 ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEK------ 54 1fs0g.pdb 1 ------KITKAM-------EMVAAS----KMRKSQDRMAASRPYAETMRKVIGHLAHYKH 43 K R Y 1e79g.pdb 55 ---ADIKTPE----LIIGVSSDRGLCGAIHSSVAKQMKSEAANL----KEVKIIGVGDKI 103 1fs0g.pdb 44 PYLEDRD---VKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKG 100 D VS DRGLCG K E G K 1e79g.pdb 104 RSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNS---GYEFDEGSIIFNRFRSVI 160 1fs0g.pdb 101 VSFFNS-VGGNVVAQVTGMGD-NPSLSELIGPVKVMLQAYDEG-RLDKLYIVSNKFINTM 157 S G P L G D I N F 1e79g.pdb 161 SYKTEEKPIFSLDTISSAESMSIYD-----------DI-DADVLRNYQEYSLANIIYYSL 208 1fs0g.pdb 158 SQVPTISQLL-P-------------LPKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGV 203 S L Y 1e79g.pdb 209 KESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL 263 1fs0g.pdb 204 VENLASEQAARMVAMK--------------------------------------- 219 E SEQ ARM AM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################