################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:14:03 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/5_3_exonuclease.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bgxt.pdb # 2: 1xo1a.pdb # # Length: 318 # Identity: 37/318 ( 11.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/318 ( 11.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 106/318 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bgxt.pdb 1 MRGMLPLFEPKG-RVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKED- 58 1xo1a.pdb 1 -----------RRNLMIVDGTNLGFRF---------------PFASSYVSTIQSLAKSYS 34 VDG L R K 1bgxt.pdb 59 GDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPED----FPRQLALIKELVDLLGLARLEVP 114 1xo1a.pdb 35 ARTTIVLGDK-GK----SVFRLEHL--------PEYAFFEYLKDAFELCKT-TFPTFTIR 80 IV D F L EL 1bgxt.pdb 115 GYEADDVLASLAKKAEKEGYEVRILTADKD-LYQLLSDRIHVLHPEG-YLITPAWLWEKY 172 1xo1a.pdb 81 GVEADDMAAYIVKLIGHLYDHVWLIS-TDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHH 139 G EADD A K V LL D E 1bgxt.pdb 173 G-LRPDQWADYRALTGD-ESDNLPGVKGIGEKTARKLLEEWG-SLEALLK-----NLD-- 222 1xo1a.pdb 140 NVDDVEQFISLKAIMG-DLGDNIRGVEG---I-GAKRGYNIIREFGN---VLDIIDQLPL 191 Q A G DN GV G K 1bgxt.pdb 223 R-LKPAIREKILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREP-------------DRER 268 1xo1a.pdb 192 PGKQKY-IQNLNASEELLFRNLILVDLP---------------TYCVDAIAAVGQDVLDK 235 A L L 1bgxt.pdb 269 LRAFLERLEFGSLLHEF- 285 1xo1a.pdb 236 FTKDILEIA--------E 245 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################